![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
![]() | Protein automated matches [226839] (35 species) not a true protein |
![]() | Species Legionella pneumophila [TaxId:272624] [225487] (1 PDB entry) |
![]() | Domain d3djcg1: 3djc G:0-122 [209194] automated match to d3bexa1 complexed with gol |
PDB Entry: 3djc (more details), 2.4 Å
SCOPe Domain Sequences for d3djcg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3djcg1 c.55.1.0 (G:0-122) automated matches {Legionella pneumophila [TaxId: 272624]} slilcidvgnshiyggvfdgdeiklrfrhtskvstsdelgiflksvlrenncspetirki aicsvvpqvdyslrsacvkyfsidpfllqagvktglnikyrnpvevgadrianaiaaths fpn
Timeline for d3djcg1: