Lineage for d3djcf1 (3djc F:1-122)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1857401Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1858517Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1858518Protein automated matches [226839] (49 species)
    not a true protein
  7. 1858775Species Legionella pneumophila [TaxId:272624] [225487] (1 PDB entry)
  8. 1858786Domain d3djcf1: 3djc F:1-122 [209192]
    automated match to d3bexa1
    complexed with gol

Details for d3djcf1

PDB Entry: 3djc (more details), 2.4 Å

PDB Description: crystal structure of pantothenate kinase from legionella pneumophila
PDB Compounds: (F:) Type III pantothenate kinase

SCOPe Domain Sequences for d3djcf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3djcf1 c.55.1.0 (F:1-122) automated matches {Legionella pneumophila [TaxId: 272624]}
lilcidvgnshiyggvfdgdeiklrfrhtskvstsdelgiflksvlrenncspetirkia
icsvvpqvdyslrsacvkyfsidpfllqagvktglnikyrnpvevgadrianaiaathsf
pn

SCOPe Domain Coordinates for d3djcf1:

Click to download the PDB-style file with coordinates for d3djcf1.
(The format of our PDB-style files is described here.)

Timeline for d3djcf1: