Lineage for d3dj4a1 (3dj4 A:6-263)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2149496Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2149497Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2150446Family c.68.1.0: automated matches [191551] (1 protein)
    not a true family
  6. 2150447Protein automated matches [190951] (26 species)
    not a true protein
  7. 2150526Species Mycobacterium tuberculosis [TaxId:1773] [224907] (7 PDB entries)
  8. 2150531Domain d3dj4a1: 3dj4 A:6-263 [209180]
    Other proteins in same PDB: d3dj4a2
    automated match to d1hm9a2
    complexed with co, mg, ud1

Details for d3dj4a1

PDB Entry: 3dj4 (more details), 2.38 Å

PDB Description: crystal structure of glmu from mycobacterium tuberculosis in complex with uridine-diphosphate-n-acetylglucosamine.
PDB Compounds: (A:) Bifunctional protein glmU

SCOPe Domain Sequences for d3dj4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dj4a1 c.68.1.0 (A:6-263) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
dtavlvlaagpgtrmrsdtpkvlhtlagrsmlshvlhaiaklapqrlivvlghdhqriap
lvgeladtlgrtidvalqdrplgtghavlcglsalpddyagnvvvtsgdtplldadtlad
liathravsaavtvltttlddpfgygrilrtqdhevmaiveqtdatpsqreirevnagvy
afdiaalrsalsrlssnnaqqelyltdviailrsdgqtvhashvddsalvagvnnrvqla
elaselnrrvvaahqlag

SCOPe Domain Coordinates for d3dj4a1:

Click to download the PDB-style file with coordinates for d3dj4a1.
(The format of our PDB-style files is described here.)

Timeline for d3dj4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3dj4a2