SCOPe 2.03: Domain d3dj4a1: 3dj4 A:6-263

Lineage for d3dj4a1 (3dj4 A:6-263)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest

4. Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families)

5. Family c.68.1.0: automated matches [191551] (1 protein)
   not a true family

6. Protein automated matches [190951] (20 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [224907] (7 PDB entries)

8. Domain d3dj4a1: 3dj4 A:6-263 [209180]
   Other proteins in same PDB: d3dj4a2
   automated match to d1hm9a2
   complexed with co, mg, ud1

Details for d3dj4a1

PDB Entry: 3dj4, 2.38 Å

PDB Description: crystal structure of glmu from mycobacterium tuberculosis in complex with uridine-diphosphate-n-acetylglucosamine.

PDB Compounds: (A:) Bifunctional protein glmU

SCOPe Domain Sequences for d3dj4a1:

Sequence; same for both SEQRES and ATOM records:

>d3dj4a1 c.68.1.0 (A:6-263) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
dtavlvlaagpgtrmrsdtpkvlhtlagrsmlshvlhaiaklapqrlivvlghdhqriap
lvgeladtlgrtidvalqdrplgtghavlcglsalpddyagnvvvtsgdtplldadtlad
liathravsaavtvltttlddpfgygrilrtqdhevmaiveqtdatpsqreirevnagvy
afdiaalrsalsrlssnnaqqelyltdviailrsdgqtvhashvddsalvagvnnrvqla
elaselnrrvvaahqlag

Timeline for d3dj4a1:

• d3dj4a1 is new in SCOPe 2.03-stable
  
• d3dj4a1 appears in SCOPe 2.04
  
• d3dj4a1 appears in the current release, SCOPe 2.08