SCOP 1.55: Domain d2dbll2: 2dbl L:108-211

Lineage for d2dbll2 (2dbl L:108-211)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species Fab DB3 (mouse), kappa L chain [48981] (6 PDB entries)

8. Domain d2dbll2: 2dbl L:108-211 [20918]
   Other proteins in same PDB: d2dblh1, d2dbll1

Details for d2dbll2

PDB Entry: 2dbl, 2.9 Å

PDB Description: molecular basis of cross-reactivity and the limits of antibody-antigen complementarity

SCOP Domain Sequences for d2dbll2:

Sequence; same for both SEQRES and ATOM records:

>d2dbll2 b.1.1.2 (L:108-211) Immunoglobulin (constant domains of L and H chains) {Fab DB3 (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOP Domain Coordinates for d2dbll2 are not available.

Timeline for d2dbll2:

• d2dbll2 appears in SCOP 1.57
  
• d2dbll2 appears in the current release, SCOPe 2.08