Lineage for d3dgba2 (3dgb A:133-374)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2837252Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2837253Protein automated matches [226923] (79 species)
    not a true protein
  7. 2837697Species Pseudomonas fluorescens [TaxId:220664] [225447] (3 PDB entries)
  8. 2837698Domain d3dgba2: 3dgb A:133-374 [209171]
    Other proteins in same PDB: d3dgba1
    automated match to d1f9ca1
    complexed with mg, muc

Details for d3dgba2

PDB Entry: 3dgb (more details), 1.7 Å

PDB Description: crystal structure of muconate lactonizing enzyme from pseudomonas fluorescens complexed with muconolactone
PDB Compounds: (A:) Muconate cycloisomerase

SCOPe Domain Sequences for d3dgba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dgba2 c.1.11.0 (A:133-374) automated matches {Pseudomonas fluorescens [TaxId: 220664]}
rvrdalpvawtlasgdtakdiaeaqkmldlrrhrifklkigagevdrdlahviaikkalg
dsasvrvdvnqawdeavalracrilggngidlieqpisrnnragmvrlnasspapimade
siecvedafnlaregaasvfalkiaknggpratlrtaaiaeaagiglyggtmleggigtl
asahafltlnklswdtelfgpllltedilaeppvyrdfhlhvskapglglsldeerlaff
rr

SCOPe Domain Coordinates for d3dgba2:

Click to download the PDB-style file with coordinates for d3dgba2.
(The format of our PDB-style files is described here.)

Timeline for d3dgba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3dgba1