SCOPe 2.08: Domain d3dg7d1: 3dg7 D:1-124

Lineage for d3dg7d1 (3dg7 D:1-124)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (95 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:246196] [225617] (5 PDB entries)

8. Domain d3dg7d1: 3dg7 D:1-124 [209168]
   Other proteins in same PDB: d3dg7a2, d3dg7b2, d3dg7c2, d3dg7d2
   automated match to d1nu5a2
   complexed with mg, muc

Details for d3dg7d1

PDB Entry: 3dg7, 2 Å

PDB Description: crystal structure of muconate lactonizing enzyme from mucobacterium smegmatis complexed with muconolactone

PDB Compounds: (D:) Muconate cycloisomerase

SCOPe Domain Sequences for d3dg7d1:

Sequence; same for both SEQRES and ATOM records:

>d3dg7d1 d.54.1.0 (D:1-124) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
mkivaigaipfsipytkplrfasgevhaaehvlvrvhtddgivgvaeapprpftygetqt
givavieqyfapaligltlterevahtrmartvgnptakaaidmamwdalgqslrlsvse
mlgg

Timeline for d3dg7d1:

• d3dg7d1 first appeared in SCOPe 2.03
  
• d3dg7d1 appears in SCOPe 2.07