Lineage for d3dg6a1 (3dg6 A:1-124)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904959Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1904960Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1905229Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1905230Protein automated matches [226922] (83 species)
    not a true protein
  7. 1905622Species Mycobacterium smegmatis [TaxId:246196] [225617] (5 PDB entries)
  8. 1905623Domain d3dg6a1: 3dg6 A:1-124 [209160]
    Other proteins in same PDB: d3dg6a2
    automated match to d1nu5a2
    complexed with mg, muc

Details for d3dg6a1

PDB Entry: 3dg6 (more details), 1.6 Å

PDB Description: crystal structure of muconate lactonizing enzyme from mucobacterium smegmatis complexed with muconolactone
PDB Compounds: (A:) Muconate cycloisomerase

SCOPe Domain Sequences for d3dg6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dg6a1 d.54.1.0 (A:1-124) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
mkivaigaipfsipytkplrfasgevhaaehvlvrvhtddgivgvaeapprpftygetqt
givavieqyfapaligltlterevahtrmartvgnptakaaidmamwdalgqslrlsvse
mlgg

SCOPe Domain Coordinates for d3dg6a1:

Click to download the PDB-style file with coordinates for d3dg6a1.
(The format of our PDB-style files is described here.)

Timeline for d3dg6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3dg6a2