| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
| Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
| Protein automated matches [226922] (95 species) not a true protein |
| Species Mycobacterium smegmatis [TaxId:246196] [225617] (5 PDB entries) |
| Domain d3dg6a1: 3dg6 A:1-124 [209160] Other proteins in same PDB: d3dg6a2 automated match to d1nu5a2 complexed with mg, muc |
PDB Entry: 3dg6 (more details), 1.6 Å
SCOPe Domain Sequences for d3dg6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dg6a1 d.54.1.0 (A:1-124) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
mkivaigaipfsipytkplrfasgevhaaehvlvrvhtddgivgvaeapprpftygetqt
givavieqyfapaligltlterevahtrmartvgnptakaaidmamwdalgqslrlsvse
mlgg
Timeline for d3dg6a1: