Lineage for d3dg3a1 (3dg3 A:1-124)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904959Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1904960Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1905229Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1905230Protein automated matches [226922] (83 species)
    not a true protein
  7. 1905622Species Mycobacterium smegmatis [TaxId:246196] [225617] (5 PDB entries)
  8. 1905624Domain d3dg3a1: 3dg3 A:1-124 [209158]
    Other proteins in same PDB: d3dg3a2
    automated match to d1nu5a2
    complexed with mg

Details for d3dg3a1

PDB Entry: 3dg3 (more details), 1.6 Å

PDB Description: crystal structure of muconate lactonizing enzyme from mucobacterium smegmatis
PDB Compounds: (A:) Muconate cycloisomerase

SCOPe Domain Sequences for d3dg3a1:

Sequence, based on SEQRES records: (download)

>d3dg3a1 d.54.1.0 (A:1-124) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
mkivaigaipfsipytkplrfasgevhaaehvlvrvhtddgivgvaeapprpftygetqt
givavieqyfapaligltlterevahtrmartvgnptakaaidmamwdalgqslrlsvse
mlgg

Sequence, based on observed residues (ATOM records): (download)

>d3dg3a1 d.54.1.0 (A:1-124) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
mkivaigaipfsipytaaehvlvrvhtddgivgvaeapprpftygetqtgivavieqyfa
paligltlterevahtrmartvgnptakaaidmamwdalgqslrlsvsemlgg

SCOPe Domain Coordinates for d3dg3a1:

Click to download the PDB-style file with coordinates for d3dg3a1.
(The format of our PDB-style files is described here.)

Timeline for d3dg3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3dg3a2