Lineage for d1dbah2 (1dba H:113-228)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 159225Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)
  7. 159809Species Fab DB3 (mouse), kappa L chain [48981] (6 PDB entries)
  8. 159814Domain d1dbah2: 1dba H:113-228 [20913]
    Other proteins in same PDB: d1dbah1, d1dbal1

Details for d1dbah2

PDB Entry: 1dba (more details), 2.8 Å

PDB Description: three-dimensional structure of an anti-steroid fab' and progesterone-fab' complex

SCOP Domain Sequences for d1dbah2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dbah2 b.1.1.2 (H:113-228) Immunoglobulin (constant domains of L and H chains) {Fab DB3 (mouse), kappa L chain}
sakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
dlytlsssvtvpssprpsetvtcnvahpasstkvdkkivpr

SCOP Domain Coordinates for d1dbah2:

Click to download the PDB-style file with coordinates for d1dbah2.
(The format of our PDB-style files is described here.)

Timeline for d1dbah2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dbah1