Lineage for d3dfyb1 (3dfy B:3-124)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904959Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1904960Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1905229Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1905230Protein automated matches [226922] (83 species)
    not a true protein
  7. 1905874Species Thermotoga maritima [TaxId:243274] [225439] (5 PDB entries)
  8. 1905888Domain d3dfyb1: 3dfy B:3-124 [209128]
    Other proteins in same PDB: d3dfya2, d3dfyb2, d3dfyc2, d3dfyd2, d3dfye2, d3dfyf2, d3dfyg2, d3dfyh2, d3dfyi2, d3dfyj2, d3dfyk2, d3dfyl2, d3dfym2, d3dfyn2, d3dfyo2, d3dfyp2
    automated match to d1jpma2
    complexed with mg

Details for d3dfyb1

PDB Entry: 3dfy (more details), 2.1 Å

PDB Description: Crystal structure of apo dipeptide epimerase from Thermotoga maritima
PDB Compounds: (B:) Muconate cycloisomerase

SCOPe Domain Sequences for d3dfyb1:

Sequence, based on SEQRES records: (download)

>d3dfyb1 d.54.1.0 (B:3-124) automated matches {Thermotoga maritima [TaxId: 243274]}
rivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngervea
llaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcyll
gg

Sequence, based on observed residues (ATOM records): (download)

>d3dfyb1 d.54.1.0 (B:3-124) automated matches {Thermotoga maritima [TaxId: 243274]}
rivnvklslkryeyekpesrnveveivlesgvkgygeaspsfrvngerveallaienavr
emitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcyllgg

SCOPe Domain Coordinates for d3dfyb1:

Click to download the PDB-style file with coordinates for d3dfyb1.
(The format of our PDB-style files is described here.)

Timeline for d3dfyb1: