Lineage for d3dfla_ (3dfl A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1318222Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1318223Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1320532Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 1320533Protein automated matches [190438] (15 species)
    not a true protein
  7. 1320547Species Human (Homo sapiens) [TaxId:9606] [187421] (33 PDB entries)
  8. 1320560Domain d3dfla_: 3dfl A: [209125]
    automated match to d2f9na_
    complexed with gbs

Details for d3dfla_

PDB Entry: 3dfl (more details), 2 Å

PDB Description: crystal structure of human prostasin complexed to 4-guanidinobenzoic acid
PDB Compounds: (A:) Prostasin

SCOPe Domain Sequences for d3dfla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dfla_ b.47.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
itggssavagqwpwqvsityegvhvcggslvseqwvlsaahcfpsehhkeayevklgahq
ldsysedakvstlkdiiphpsylqegsqgdiallqlsrpitfsryirpislpaanasfpn
glhctvtgwghvapsvslltpkplqqlevplisretcnalynidakpeephfvqedmvca
gyveggkdacqgdsggplscpveglwyltgivswgdacgarnrpgvytlassyaswiqsk
vtelq

SCOPe Domain Coordinates for d3dfla_:

Click to download the PDB-style file with coordinates for d3dfla_.
(The format of our PDB-style files is described here.)

Timeline for d3dfla_: