![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
![]() | Protein automated matches [190417] (37 species) not a true protein |
![]() | Species Cryptosporidium parvum [TaxId:353152] [196400] (5 PDB entries) |
![]() | Domain d3dfaa1: 3dfa A:1-267 [209123] Other proteins in same PDB: d3dfaa2 automated match to d3niza_ |
PDB Entry: 3dfa (more details), 2.45 Å
SCOPe Domain Sequences for d3dfaa1:
Sequence, based on SEQRES records: (download)
>d3dfaa1 d.144.1.0 (A:1-267) automated matches {Cryptosporidium parvum [TaxId: 353152]} gtfaerynivcmlgkgsfgevlkckdritqqeyavkvinkasaknkdtstilrevellkk ldhpnimklfeiledsssfyivgelytggelfdeiikrkrfsehdaariikqvfsgitym hkhnivhrdlkpenilleskekdcdikiidfglstcfqqntkmkdrigtayyiapevlrg tydekcdvwsagvilyillsgtppfygkneydilkrvetgkyafdlpqwrtisddakdli rkmltfhpslritatqclehpwiqkys
>d3dfaa1 d.144.1.0 (A:1-267) automated matches {Cryptosporidium parvum [TaxId: 353152]} gtfaerynivcmlgkgsfgevlkckdritqqeyavkvinkasaknkdtstilrevellkk ldhpnimklfeiledsssfyivgelytgelfdeiikrkrfsehdaariikqvfsgitymh khnivhrdlkpenillkdcdikiidfglstcfqqntkmkdrigtayyiapevlrgtydek cdvwsagvilyillsgtppfygkneydilkrvetgkyafdlpqwrtisddakdlirkmlt fhpslritatqclehpwiqkys
Timeline for d3dfaa1: