| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
| Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
| Protein automated matches [226923] (79 species) not a true protein |
| Species Thermotoga maritima [TaxId:243274] [225440] (5 PDB entries) |
| Domain d3desd2: 3des D:125-343 [209120] Other proteins in same PDB: d3desa1, d3desb1, d3desc1, d3desd1 automated match to d1jpma1 complexed with ala, mg |
PDB Entry: 3des (more details), 2.3 Å
SCOPe Domain Sequences for d3desd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3desd2 c.1.11.0 (D:125-343) automated matches {Thermotoga maritima [TaxId: 243274]}
krdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvtrgak
yivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaadesa
rtkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslginqsv
hfalgtgafefhdldshlmlkeevfrgkfiqdgprmrvk
Timeline for d3desd2: