SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3desb2 (3des B:125-343)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2086988Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2087392Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2087393Protein automated matches [226923] (72 species)
    not a true protein
  7. 2087953Species Thermotoga maritima [TaxId:243274] [225440] (5 PDB entries)
  8. 2087983Domain d3desb2: 3des B:125-343 [209116]
    Other proteins in same PDB: d3desa1, d3desb1, d3desc1, d3desd1
    automated match to d1jpma1
    complexed with ala, mg

Details for d3desb2

PDB Entry: 3des (more details), 2.3 Å

PDB Description: Crystal structure of dipeptide epimerase from Thermotoga maritima complexed with L-Ala-L-Phe dipeptide
PDB Compounds: (B:) Muconate cycloisomerase

SCOPe Domain Sequences for d3desb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3desb2 c.1.11.0 (B:125-343) automated matches {Thermotoga maritima [TaxId: 243274]}
krdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvtrgak
yivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaadesa
rtkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslginqsv
hfalgtgafefhdldshlmlkeevfrgkfiqdgprmrvk

SCOPe Domain Coordinates for d3desb2:

Click to download the PDB-style file with coordinates for d3desb2.
(The format of our PDB-style files is described here.)

Timeline for d3desb2: