Lineage for d3desa1 (3des A:3-124)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1412713Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1412714Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1412983Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1412984Protein automated matches [226922] (55 species)
    not a true protein
  7. 1413299Species Thermotoga maritima [TaxId:243274] [225439] (5 PDB entries)
  8. 1413328Domain d3desa1: 3des A:3-124 [209113]
    Other proteins in same PDB: d3desa2, d3desb2, d3desc2, d3desd2
    automated match to d1jpma2
    complexed with ala, mg

Details for d3desa1

PDB Entry: 3des (more details), 2.3 Å

PDB Description: Crystal structure of dipeptide epimerase from Thermotoga maritima complexed with L-Ala-L-Phe dipeptide
PDB Compounds: (A:) Muconate cycloisomerase

SCOPe Domain Sequences for d3desa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3desa1 d.54.1.0 (A:3-124) automated matches {Thermotoga maritima [TaxId: 243274]}
rivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngervea
llaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcyll
gg

SCOPe Domain Coordinates for d3desa1:

Click to download the PDB-style file with coordinates for d3desa1.
(The format of our PDB-style files is described here.)

Timeline for d3desa1: