SCOPe 2.08: Domain d3derd1: 3der D:3-124

Lineage for d3derd1 (3der D:3-124)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (95 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [225439] (5 PDB entries)

8. Domain d3derd1: 3der D:3-124 [209111]
   Other proteins in same PDB: d3dera2, d3derb2, d3derc2, d3derd2
   automated match to d1jpma2
   complexed with ala, mg

Details for d3derd1

PDB Entry: 3der, 1.9 Å

PDB Description: Crystal structure of dipeptide epimerase from Thermotoga maritima complexed with L-Ala-L-Lys dipeptide

PDB Compounds: (D:) Muconate cycloisomerase

SCOPe Domain Sequences for d3derd1:

Sequence; same for both SEQRES and ATOM records:

>d3derd1 d.54.1.0 (D:3-124) automated matches {Thermotoga maritima [TaxId: 243274]}
rivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngervea
llaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcyll
gg

Timeline for d3derd1:

• d3derd1 first appeared in SCOPe 2.03
  
• d3derd1 appears in SCOPe 2.07