SCOPe 2.08: Domain d3deqb1: 3deq B:3-124

Lineage for d3deqb1 (3deq B:3-124)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (95 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [225439] (5 PDB entries)

8. Domain d3deqb1: 3deq B:3-124 [209099]
   Other proteins in same PDB: d3deqa2, d3deqb2, d3deqc2, d3deqd2
   automated match to d1jpma2
   complexed with ala, mg

Details for d3deqb1

PDB Entry: 3deq, 2.1 Å

PDB Description: Crystal structure of dipeptide epimerase from Thermotoga maritima complexed with L-Ala-L-Leu dipeptide

PDB Compounds: (B:) Muconate cycloisomerase

SCOPe Domain Sequences for d3deqb1:

Sequence; same for both SEQRES and ATOM records:

>d3deqb1 d.54.1.0 (B:3-124) automated matches {Thermotoga maritima [TaxId: 243274]}
rivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngervea
llaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcyll
gg

Timeline for d3deqb1:

• d3deqb1 first appeared in SCOPe 2.03
  
• d3deqb1 appears in SCOPe 2.07