SCOPe 2.05: Domain d3ddua2: 3ddu A:431-710

Lineage for d3ddua2 (3ddu A:431-710)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.4: Prolyl oligopeptidase, C-terminal domain [53496] (2 proteins)
   N-terminal domain is a 7-bladed beta-propeller
   automatically mapped to Pfam PF00326

6. Protein automated matches [226978] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225502] (1 PDB entry)

8. Domain d3ddua2: 3ddu A:431-710 [209096]
   Other proteins in same PDB: d3ddua1
   automated match to d1e5ta2
   complexed with 552, act, gol

Details for d3ddua2

PDB Entry: 3ddu, 1.56 Å

PDB Description: prolyl oligopeptidase with gsk552

PDB Compounds: (A:) prolyl endopeptidase

SCOPe Domain Sequences for d3ddua2:

Sequence; same for both SEQRES and ATOM records:

>d3ddua2 c.69.1.4 (A:431-710) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dasdyqtvqifypskdgtkipmfivhkkgikldgshpaflygyggfnisitpnysvsrli
fvrhmggilavanirgggeygetwhkggilankqncfddfqcaaeylikegytspkrlti
nggsnggllvaacanqrpdlfgcviaqvgvmdmlkfhkytighawttdygcsdskqhfew
lvkysplhnvklpeaddiqypsmllltadhddrvvplhslkfiatlqyivgrsrkqnnpl
lihvdtkaghgagkptakvieevsdmfafiarclnvdwip

Timeline for d3ddua2:

• d3ddua2 first appeared in SCOPe 2.03
  
• d3ddua2 appears in SCOPe 2.04
  
• d3ddua2 appears in SCOPe 2.06
  
• d3ddua2 appears in the current release, SCOPe 2.08