Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.4: Prolyl oligopeptidase, C-terminal domain [53496] (2 proteins) N-terminal domain is a 7-bladed beta-propeller automatically mapped to Pfam PF00326 |
Protein automated matches [226978] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225502] (1 PDB entry) |
Domain d3ddua2: 3ddu A:431-710 [209096] Other proteins in same PDB: d3ddua1 automated match to d1e5ta2 complexed with 552, act, gol |
PDB Entry: 3ddu (more details), 1.56 Å
SCOPe Domain Sequences for d3ddua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ddua2 c.69.1.4 (A:431-710) automated matches {Human (Homo sapiens) [TaxId: 9606]} dasdyqtvqifypskdgtkipmfivhkkgikldgshpaflygyggfnisitpnysvsrli fvrhmggilavanirgggeygetwhkggilankqncfddfqcaaeylikegytspkrlti nggsnggllvaacanqrpdlfgcviaqvgvmdmlkfhkytighawttdygcsdskqhfew lvkysplhnvklpeaddiqypsmllltadhddrvvplhslkfiatlqyivgrsrkqnnpl lihvdtkaghgagkptakvieevsdmfafiarclnvdwip
Timeline for d3ddua2: