Lineage for d3ddua1 (3ddu A:2-430)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2066277Superfamily b.69.7: Peptidase/esterase 'gauge' domain [50993] (3 families) (S)
  5. 2066278Family b.69.7.1: Prolyl oligopeptidase, N-terminal domain [50994] (2 protein domains)
    automatically mapped to Pfam PF02897
  6. 2066308Protein automated matches [226977] (2 species)
    not a true protein
  7. 2066309Species Human (Homo sapiens) [TaxId:9606] [225501] (1 PDB entry)
  8. 2066310Domain d3ddua1: 3ddu A:2-430 [209095]
    Other proteins in same PDB: d3ddua2
    automated match to d1e5ta1
    complexed with 552, act, gol

Details for d3ddua1

PDB Entry: 3ddu (more details), 1.56 Å

PDB Description: prolyl oligopeptidase with gsk552
PDB Compounds: (A:) prolyl endopeptidase

SCOPe Domain Sequences for d3ddua1:

Sequence, based on SEQRES records: (download)

>d3ddua1 b.69.7.1 (A:2-430) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lsfqypdvyrdetavqdyhghkicdpyawledpdseqtkafveaqnkitvpfleqcpirg
lykermtelydypkyschfkkgkryfyfyntglqnqrvlyvqdslegearvfldpnilsd
dgtvalrgyafsedgeyfayglsasgsdwvtikfmkvdgakelpdvlervkfscmawthd
gkgmfynsypqqdgksdgtetstnlhqklyyhvlgtdqsedilcaefpdepkwmggaels
ddgryvllsiregcdpvnrlwycdlqqessgiagilkwvklidnfegeydyvtnegtvft
fktnrhspnyrvinidftdpeeskwkvlvpehekdvlewiacvrsnflvlcylhdvkntl
qlhdlttgallkifpldvgsivgysgqkkdteifyqftsflspgiiyhcdltkeeleprv
frevtvkgi

Sequence, based on observed residues (ATOM records): (download)

>d3ddua1 b.69.7.1 (A:2-430) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lsfqypdvyrdetavqdyhghkicdpyawledpdseqtkafveaqnkitvpfleqcpirg
lykermtelydypkyschfkkgkryfyfyntglqnqrvlyvqdslegearvfldpnilsd
dgtvalrgyafsedgeyfayglsasgsdwvtikfmkvdgakelpdvlervkfscmawthd
gkgmfynsypqqdgksdgtetstnlhqklyyhvlgtdqsedilcaefpdepkwmggaels
ddgryvllsiregcdpvnrlwycdlqqessgiagilkwvklidnfegeydyvtnegtvft
fktnrhspnyrvinidftdpeeskwkvlvpehekdvlewiacvrsnflvlcylhdvkntl
qlhdlttgallkifpldvgsivgysgqkkdteifyqftsflspgiiyhcdltkeeleprv
frevvki

SCOPe Domain Coordinates for d3ddua1:

Click to download the PDB-style file with coordinates for d3ddua1.
(The format of our PDB-style files is described here.)

Timeline for d3ddua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ddua2