Lineage for d3dd6a1 (3dd6 A:1-151)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930318Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (11 proteins)
  6. 2930436Protein Ribonuclease PH, domain 1 [102758] (4 species)
  7. 2930442Species Bacillus anthracis [225599] (1 PDB entry)
  8. 2930443Domain d3dd6a1: 3dd6 A:1-151 [209093]
    Other proteins in same PDB: d3dd6a2
    automated match to d1oypa1
    complexed with so4

Details for d3dd6a1

PDB Entry: 3dd6 (more details), 1.7 Å

PDB Description: crystal structure of rph, an exoribonuclease from bacillus anthracis at 1.7 a resolution
PDB Compounds: (A:) Ribonuclease PH

SCOPe Domain Sequences for d3dd6a1:

Sequence, based on SEQRES records: (download)

>d3dd6a1 d.14.1.4 (A:1-151) Ribonuclease PH, domain 1 {Bacillus anthracis}
mrvdgrektelrhihihtnylkhpegsvlievgdtkvicsatieervppfmrgegkgwvt
aeyamiprateqrtiresskgkvtgrtmeiqrligralravvdlealgertvwidcdviq
adggtrtasitgayvamvlafekllqaekvs

Sequence, based on observed residues (ATOM records): (download)

>d3dd6a1 d.14.1.4 (A:1-151) Ribonuclease PH, domain 1 {Bacillus anthracis}
mrvdgrektelrhihihtnylkhpegsvlievgdtkvicsatieervppfmrgegkgwvt
aeyamiprateqrtiressgkvtgrtmeiqrligralravvdlealgertvwidcdviqa
dggtrtasitgayvamvlafekllqaekvs

SCOPe Domain Coordinates for d3dd6a1:

Click to download the PDB-style file with coordinates for d3dd6a1.
(The format of our PDB-style files is described here.)

Timeline for d3dd6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3dd6a2