Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (11 proteins) |
Protein Ribonuclease PH, domain 1 [102758] (4 species) |
Species Bacillus anthracis [225599] (1 PDB entry) |
Domain d3dd6a1: 3dd6 A:1-151 [209093] Other proteins in same PDB: d3dd6a2 automated match to d1oypa1 complexed with so4 |
PDB Entry: 3dd6 (more details), 1.7 Å
SCOPe Domain Sequences for d3dd6a1:
Sequence, based on SEQRES records: (download)
>d3dd6a1 d.14.1.4 (A:1-151) Ribonuclease PH, domain 1 {Bacillus anthracis} mrvdgrektelrhihihtnylkhpegsvlievgdtkvicsatieervppfmrgegkgwvt aeyamiprateqrtiresskgkvtgrtmeiqrligralravvdlealgertvwidcdviq adggtrtasitgayvamvlafekllqaekvs
>d3dd6a1 d.14.1.4 (A:1-151) Ribonuclease PH, domain 1 {Bacillus anthracis} mrvdgrektelrhihihtnylkhpegsvlievgdtkvicsatieervppfmrgegkgwvt aeyamiprateqrtiressgkvtgrtmeiqrligralravvdlealgertvwidcdviqa dggtrtasitgayvamvlafekllqaekvs
Timeline for d3dd6a1: