SCOPe 2.07: Domain d3dd3a2: 3dd3 A:77-209

Lineage for d3dd3a2 (3dd3 A:77-209)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class pi GST [81347] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47619] (66 PDB entries)

8. Domain d3dd3a2: 3dd3 A:77-209 [209090]
   Other proteins in same PDB: d3dd3a1, d3dd3b1
   automated match to d13gsa1
   complexed with gsh, mes, ruc

Details for d3dd3a2

PDB Entry: 3dd3, 2.25 Å

PDB Description: Crystal Structure of the Glutathione Transferase Pi enzyme in complex with the bifunctional inhibitor, Etharapta

PDB Compounds: (A:) Glutathione S-transferase P

SCOPe Domain Sequences for d3dd3a2:

Sequence; same for both SEQRES and ATOM records:

>d3dd3a2 a.45.1.1 (A:77-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

Timeline for d3dd3a2:

• d3dd3a2 first appeared in SCOPe 2.03
  
• d3dd3a2 appears in SCOPe 2.06
  
• d3dd3a2 appears in the current release, SCOPe 2.08