SCOPe 2.07: Domain d3dc6c1: 3dc6 C:0-85

Lineage for d3dc6c1 (3dc6 C:0-85)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.0: automated matches [227154] (1 protein)
   not a true family

6. Protein automated matches [226859] (38 species)
   not a true protein

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [225668] (8 PDB entries)

8. Domain d3dc6c1: 3dc6 C:0-85 [209086]
   Other proteins in same PDB: d3dc6a2, d3dc6c2
   automated match to d1bsma1
   complexed with mn, so4

Details for d3dc6c1

PDB Entry: 3dc6, 1.8 Å

PDB Description: Crystal Structure of a manganese superoxide dismutases from Caenorhabditis elegans

PDB Compounds: (C:) Superoxide dismutase [Mn] 1

SCOPe Domain Sequences for d3dc6c1:

Sequence; same for both SEQRES and ATOM records:

>d3dc6c1 a.2.11.0 (C:0-85) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
mkhslpdlpydyadlepvisheimqlhhqkhhatyvnnlnqieeklheavskgnvkeaia
lqpalkfnggghinhsifwtnlakdg

Timeline for d3dc6c1:

• d3dc6c1 first appeared in SCOPe 2.03
  
• d3dc6c1 appears in SCOPe 2.06
  
• d3dc6c1 appears in the current release, SCOPe 2.08