Lineage for d3dc6c1 (3dc6 C:0-85)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2303207Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2303511Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2303798Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 2303799Protein automated matches [226859] (38 species)
    not a true protein
  7. 2303962Species Nematode (Caenorhabditis elegans) [TaxId:6239] [225668] (8 PDB entries)
  8. 2303966Domain d3dc6c1: 3dc6 C:0-85 [209086]
    Other proteins in same PDB: d3dc6a2, d3dc6c2
    automated match to d1bsma1
    complexed with mn, so4

Details for d3dc6c1

PDB Entry: 3dc6 (more details), 1.8 Å

PDB Description: Crystal Structure of a manganese superoxide dismutases from Caenorhabditis elegans
PDB Compounds: (C:) Superoxide dismutase [Mn] 1

SCOPe Domain Sequences for d3dc6c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dc6c1 a.2.11.0 (C:0-85) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
mkhslpdlpydyadlepvisheimqlhhqkhhatyvnnlnqieeklheavskgnvkeaia
lqpalkfnggghinhsifwtnlakdg

SCOPe Domain Coordinates for d3dc6c1:

Click to download the PDB-style file with coordinates for d3dc6c1.
(The format of our PDB-style files is described here.)

Timeline for d3dc6c1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3dc6c2