SCOPe 2.05: Domain d3dc6a2: 3dc6 A:86-197

Lineage for d3dc6a2 (3dc6 A:86-197)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.0: automated matches [227155] (1 protein)
   not a true family

6. Protein automated matches [226860] (30 species)
   not a true protein

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [225669] (3 PDB entries)

8. Domain d3dc6a2: 3dc6 A:86-197 [209085]
   Other proteins in same PDB: d3dc6a1, d3dc6c1
   automated match to d1bsma2
   complexed with mn, so4

Details for d3dc6a2

PDB Entry: 3dc6, 1.8 Å

PDB Description: Crystal Structure of a manganese superoxide dismutases from Caenorhabditis elegans

PDB Compounds: (A:) Superoxide dismutase [Mn] 1

SCOPe Domain Sequences for d3dc6a2:

Sequence; same for both SEQRES and ATOM records:

>d3dc6a2 d.44.1.0 (A:86-197) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
gepsaelltaiksdfgsldnlqkqlsastvavqgsgwgwlgycpkgkilkvatcanqdpl
eattglvplfgidvwehayylqyknvrpdyvnaiwkianwknvserfakaqq

Timeline for d3dc6a2:

• d3dc6a2 first appeared in SCOPe 2.03
  
• d3dc6a2 appears in SCOPe 2.04
  
• d3dc6a2 appears in SCOPe 2.06
  
• d3dc6a2 appears in the current release, SCOPe 2.08