| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) ![]() automatically mapped to Pfam PF02777 |
| Family d.44.1.0: automated matches [227155] (1 protein) not a true family |
| Protein automated matches [226860] (38 species) not a true protein |
| Species Nematode (Caenorhabditis elegans) [TaxId:6239] [225669] (8 PDB entries) |
| Domain d3dc6a2: 3dc6 A:86-197 [209085] Other proteins in same PDB: d3dc6a1, d3dc6c1 automated match to d1bsma2 complexed with mn, so4 |
PDB Entry: 3dc6 (more details), 1.8 Å
SCOPe Domain Sequences for d3dc6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dc6a2 d.44.1.0 (A:86-197) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
gepsaelltaiksdfgsldnlqkqlsastvavqgsgwgwlgycpkgkilkvatcanqdpl
eattglvplfgidvwehayylqyknvrpdyvnaiwkianwknvserfakaqq
Timeline for d3dc6a2: