SCOPe 2.03: Domain d3dc5c2: 3dc5 C:86-194

Lineage for d3dc5c2 (3dc5 C:86-194)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.0: automated matches [227155] (1 protein)
   not a true family

6. Protein automated matches [226860] (25 species)
   not a true protein

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [225669] (2 PDB entries)

8. Domain d3dc5c2: 3dc5 C:86-194 [209083]
   Other proteins in same PDB: d3dc5a1, d3dc5c1
   automated match to d1bsma2
   complexed with mli, mn

Details for d3dc5c2

PDB Entry: 3dc5, 1.7 Å

PDB Description: Crystal Structure of a manganese superoxide dismutases from Caenorhabditis elegans

PDB Compounds: (C:) Superoxide dismutase [Mn] 2

SCOPe Domain Sequences for d3dc5c2:

Sequence; same for both SEQRES and ATOM records:

>d3dc5c2 d.44.1.0 (C:86-194) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
gepskelmdtikrdfgsldnlqkrlsditiavqgsgwgwlgyckkdkilkiatcanqdpl
egmvplfgidvwehayylqyknvrpdyvhaiwkianwkniserfanarq

Timeline for d3dc5c2:

• d3dc5c2 is new in SCOPe 2.03-stable
  
• d3dc5c2 appears in SCOPe 2.04
  
• d3dc5c2 appears in the current release, SCOPe 2.08