![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) ![]() automatically mapped to Pfam PF00081 |
![]() | Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
![]() | Protein automated matches [226859] (39 species) not a true protein |
![]() | Species Nematode (Caenorhabditis elegans) [TaxId:6239] [225668] (8 PDB entries) |
![]() | Domain d3dc5c1: 3dc5 C:1-85 [209082] Other proteins in same PDB: d3dc5a2, d3dc5c2, d3dc5c3 automated match to d1bsma1 complexed with mli, mn |
PDB Entry: 3dc5 (more details), 1.7 Å
SCOPe Domain Sequences for d3dc5c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dc5c1 a.2.11.0 (C:1-85) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]} khtlpdlpfdyadlepvisheimqlhhqkhhatyvnnlnqieeklheavskgnlkeaial qpalkfnggghinhsifwtnlakdg
Timeline for d3dc5c1: