SCOPe 2.03: Domain d3dc5a1: 3dc5 A:1-85

Lineage for d3dc5a1 (3dc5 A:1-85)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.0: automated matches [227154] (1 protein)
   not a true family

6. Protein automated matches [226859] (26 species)
   not a true protein

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [225668] (2 PDB entries)

8. Domain d3dc5a1: 3dc5 A:1-85 [209080]
   Other proteins in same PDB: d3dc5a2, d3dc5c2
   automated match to d1bsma1
   complexed with mli, mn

Details for d3dc5a1

PDB Entry: 3dc5, 1.7 Å

PDB Description: Crystal Structure of a manganese superoxide dismutases from Caenorhabditis elegans

PDB Compounds: (A:) Superoxide dismutase [Mn] 2

SCOPe Domain Sequences for d3dc5a1:

Sequence; same for both SEQRES and ATOM records:

>d3dc5a1 a.2.11.0 (A:1-85) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
khtlpdlpfdyadlepvisheimqlhhqkhhatyvnnlnqieeklheavskgnlkeaial
qpalkfnggghinhsifwtnlakdg

Timeline for d3dc5a1:

• d3dc5a1 is new in SCOPe 2.03-stable
  
• d3dc5a1 appears in SCOPe 2.04
  
• d3dc5a1 appears in the current release, SCOPe 2.08