Lineage for d3dc4a1 (3dc4 A:4-318)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114132Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225598] (9 PDB entries)
  8. 2114135Domain d3dc4a1: 3dc4 A:4-318 [209079]
    Other proteins in same PDB: d3dc4a2
    automated match to d1f9va_
    complexed with adp, mg

Details for d3dc4a1

PDB Entry: 3dc4 (more details), 1.9 Å

PDB Description: Crystal structure of the Drosophila kinesin family member NOD in complex with ADP
PDB Compounds: (A:) Kinesin-like protein Nod

SCOPe Domain Sequences for d3dc4a1:

Sequence, based on SEQRES records: (download)

>d3dc4a1 c.37.1.0 (A:4-318) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
aklsavriavreapyrqflgrrepsvvqfppwsdgkslivdqnefhfdhafpatisqdem
yqalilplvdkllegfqctalaygqtgtgksysmgmtppgeilpehlgilpralgdifer
vtarqennkdaiqvyasfieiynekpfdllgstphmpmvaarcqrctclplhsqadlhhi
lelgtrnrrvrptnmnsnssrshaivtihvkskthhsrmnivdlagsegvrrtghegvar
qegvninlgllsinkvvmsmaaghtvipyrdsvlttvlqasltaqsyltflacisphqcd
lsetlstlrfgtsak

Sequence, based on observed residues (ATOM records): (download)

>d3dc4a1 c.37.1.0 (A:4-318) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
aklsavriavreapyrpsvvqfppwsdgkslivdqnefhfdhafpatisqdemyqalilp
lvdkllegfqctalaygqtgtgksysmgmtppgeilpehlgilpralgdifervtarqen
nkdaiqvyasfieiynekpfdllgstphmpmvaarcqrctclplhsqadlhhilelgtrn
rrsrshaivtihvkskthhsrmnivdlagsegvvninlgllsinkvvmsmaaghtvipyr
dsvlttvlqasltaqsyltflacisphqcdlsetlstlrfgtsak

SCOPe Domain Coordinates for d3dc4a1:

Click to download the PDB-style file with coordinates for d3dc4a1.
(The format of our PDB-style files is described here.)

Timeline for d3dc4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3dc4a2