Lineage for d3dc2b2 (3dc2 B:99-282)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2105396Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
    this domain interrupts the other domain which defines family
  6. 2105467Protein Phosphoglycerate dehydrogenase [51839] (2 species)
    has additional C-terminal domain of the ferredoxin fold
  7. 2105488Species Mycobacterium tuberculosis [TaxId:1773] [141927] (2 PDB entries)
    Uniprot P0A544 98-281
  8. 2105492Domain d3dc2b2: 3dc2 B:99-282 [209076]
    Other proteins in same PDB: d3dc2a1, d3dc2a3, d3dc2a4, d3dc2b1, d3dc2b3, d3dc2b4
    automated match to d1ygya1
    complexed with ser, tla

Details for d3dc2b2

PDB Entry: 3dc2 (more details), 2.7 Å

PDB Description: Crystal structure of serine bound D-3-phosphoglycerate dehydrogenase from Mycobacterium tuberculosis
PDB Compounds: (B:) D-3-phosphoglycerate dehydrogenase

SCOPe Domain Sequences for d3dc2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dc2b2 c.2.1.4 (B:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]}
nihsaaehalalllaasrqipaadaslrehtwkrssfsgteifgktvgvvglgrigqlva
qriaafgayvvaydpyvsparaaqlgiellslddllaradfisvhlpktpetaglidkea
laktkpgviivnaargglvdeaaladaitgghvraagldvfatepctdsplfelaqvvvt
phlg

SCOPe Domain Coordinates for d3dc2b2:

Click to download the PDB-style file with coordinates for d3dc2b2.
(The format of our PDB-style files is described here.)

Timeline for d3dc2b2: