Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) |
Family c.23.12.1: Formate/glycerate dehydrogenases, substrate-binding domain [52284] (7 proteins) this domain is interrupted by the Rossmann-fold domain |
Protein Phosphoglycerate dehydrogenase [52293] (2 species) has additional C-terminal domain of the ferredoxin fold |
Species Mycobacterium tuberculosis [TaxId:1773] [142063] (2 PDB entries) Uniprot P0A544 2-97,282-315 there is an intervening domain between this domain and regulatory (C-terminal) domain |
Domain d3dc2b1: 3dc2 B:4-98,B:283-316 [209075] Other proteins in same PDB: d3dc2a2, d3dc2a3, d3dc2a4, d3dc2b2, d3dc2b3, d3dc2b4 automated match to d1ygya2 complexed with ser, tla |
PDB Entry: 3dc2 (more details), 2.7 Å
SCOPe Domain Sequences for d3dc2b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dc2b1 c.23.12.1 (B:4-98,B:283-316) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} lpvvliadklapstvaalgdqvevrwvdgpdrdkllaavpeadallvrsattvdaevlaa apklkivaragvgldnvdvdaatargvlvvnaptsXastaeaqdragtdvaesvrlalag efvpdavnvg
Timeline for d3dc2b1:
View in 3D Domains from other chains: (mouse over for more information) d3dc2a1, d3dc2a2, d3dc2a3, d3dc2a4 |