| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.18: ACT-like [55021] (15 families) ![]() regulatory domain linked to a wide range of metabolic enzymes |
| Family d.58.18.1: Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain [55022] (1 protein) |
| Protein Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain [55023] (2 species) |
| Species Mycobacterium tuberculosis [TaxId:1773] [143374] (2 PDB entries) Uniprot P0A544 451-528 there is an intervening domain between the substrate-binding domain and this domain |
| Domain d3dc2a4: 3dc2 A:452-529 [209074] Other proteins in same PDB: d3dc2a1, d3dc2a2, d3dc2a3, d3dc2b1, d3dc2b2, d3dc2b3 automated match to d1ygya3 complexed with ser, tla |
PDB Entry: 3dc2 (more details), 2.7 Å
SCOPe Domain Sequences for d3dc2a4:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dc2a4 d.58.18.1 (A:452-529) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Mycobacterium tuberculosis [TaxId: 1773]}
aqginliihyvdrpgalgkigtllgtagvniqaaqlsedaegpgatillrldqdvpddvr
taiaaavdayklevvdls
Timeline for d3dc2a4:
View in 3DDomains from other chains: (mouse over for more information) d3dc2b1, d3dc2b2, d3dc2b3, d3dc2b4 |