SCOPe 2.03: Domain d3dc2a4: 3dc2 A:452-529

Lineage for d3dc2a4 (3dc2 A:452-529)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.18: ACT-like [55021] (15 families)
   regulatory domain linked to a wide range of metabolic enzymes

5. Family d.58.18.1: Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain [55022] (1 protein)

6. Protein Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain [55023] (2 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [143374] (2 PDB entries)
   Uniprot P0A544 451-528
   there is an intervening domain between the substrate-binding domain and this domain

8. Domain d3dc2a4: 3dc2 A:452-529 [209074]
   Other proteins in same PDB: d3dc2a1, d3dc2a2, d3dc2a3, d3dc2b1, d3dc2b2, d3dc2b3
   automated match to d1ygya3
   complexed with ser, tla

Details for d3dc2a4

PDB Entry: 3dc2, 2.7 Å

PDB Description: Crystal structure of serine bound D-3-phosphoglycerate dehydrogenase from Mycobacterium tuberculosis

PDB Compounds: (A:) D-3-phosphoglycerate dehydrogenase

SCOPe Domain Sequences for d3dc2a4:

Sequence; same for both SEQRES and ATOM records:

>d3dc2a4 d.58.18.1 (A:452-529) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Mycobacterium tuberculosis [TaxId: 1773]}
aqginliihyvdrpgalgkigtllgtagvniqaaqlsedaegpgatillrldqdvpddvr
taiaaavdayklevvdls

Timeline for d3dc2a4:

• d3dc2a4 is new in SCOPe 2.03-stable
  
• d3dc2a4 appears in SCOPe 2.04
  
• d3dc2a4 appears in the current release, SCOPe 2.08