![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins) this domain interrupts the other domain which defines family |
![]() | Protein Phosphoglycerate dehydrogenase [51839] (2 species) has additional C-terminal domain of the ferredoxin fold |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [141927] (2 PDB entries) Uniprot P0A544 98-281 |
![]() | Domain d3dc2a2: 3dc2 A:99-282 [209072] Other proteins in same PDB: d3dc2a1, d3dc2a3, d3dc2a4, d3dc2b1, d3dc2b3, d3dc2b4 automated match to d1ygya1 complexed with ser, tla |
PDB Entry: 3dc2 (more details), 2.7 Å
SCOPe Domain Sequences for d3dc2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dc2a2 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} nihsaaehalalllaasrqipaadaslrehtwkrssfsgteifgktvgvvglgrigqlva qriaafgayvvaydpyvsparaaqlgiellslddllaradfisvhlpktpetaglidkea laktkpgviivnaargglvdeaaladaitgghvraagldvfatepctdsplfelaqvvvt phlg
Timeline for d3dc2a2:
![]() Domains from other chains: (mouse over for more information) d3dc2b1, d3dc2b2, d3dc2b3, d3dc2b4 |