SCOPe 2.07: Domain d3dc2a2: 3dc2 A:99-282

Lineage for d3dc2a2 (3dc2 A:99-282)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
   this domain interrupts the other domain which defines family

6. Protein Phosphoglycerate dehydrogenase [51839] (2 species)
   has additional C-terminal domain of the ferredoxin fold

7. Species Mycobacterium tuberculosis [TaxId:1773] [141927] (2 PDB entries)
   Uniprot P0A544 98-281

8. Domain d3dc2a2: 3dc2 A:99-282 [209072]
   Other proteins in same PDB: d3dc2a1, d3dc2a3, d3dc2a4, d3dc2b1, d3dc2b3, d3dc2b4
   automated match to d1ygya1
   complexed with ser, tla

Details for d3dc2a2

PDB Entry: 3dc2, 2.7 Å

PDB Description: Crystal structure of serine bound D-3-phosphoglycerate dehydrogenase from Mycobacterium tuberculosis

PDB Compounds: (A:) D-3-phosphoglycerate dehydrogenase

SCOPe Domain Sequences for d3dc2a2:

Sequence; same for both SEQRES and ATOM records:

>d3dc2a2 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]}
nihsaaehalalllaasrqipaadaslrehtwkrssfsgteifgktvgvvglgrigqlva
qriaafgayvvaydpyvsparaaqlgiellslddllaradfisvhlpktpetaglidkea
laktkpgviivnaargglvdeaaladaitgghvraagldvfatepctdsplfelaqvvvt
phlg

Timeline for d3dc2a2:

• d3dc2a2 first appeared in SCOPe 2.03
  
• d3dc2a2 appears in SCOPe 2.06
  
• d3dc2a2 appears in the current release, SCOPe 2.08