SCOPe 2.08: Domain d3dc0a2: 3dc0 A:348-425

Lineage for d3dc0a2 (3dc0 A:348-425)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.0: automated matches [227134] (1 protein)
   not a true family

6. Protein automated matches [226835] (41 species)
   not a true protein

7. Species Bacillus sp. [TaxId:535911] [225473] (1 PDB entry)

8. Domain d3dc0a2: 3dc0 A:348-425 [209070]
   Other proteins in same PDB: d3dc0a1
   automated match to d1baga1
   complexed with ca

Details for d3dc0a2

PDB Entry: 3dc0, 2.78 Å

PDB Description: Crystal structure of native alpha-amylase from Bacillus sp. KR-8104

PDB Compounds: (A:) alpha-amylase

SCOPe Domain Sequences for d3dc0a2:

Sequence; same for both SEQRES and ATOM records:

>d3dc0a2 b.71.1.0 (A:348-425) automated matches {Bacillus sp. [TaxId: 535911]}
qpeelsnpngnnqifmnqrgskgvvlanagsssvsinastklpdgsydnkagtgsfqvrd
gkltgtinarsvavlypd

Timeline for d3dc0a2:

• d3dc0a2 first appeared in SCOPe 2.03
  
• d3dc0a2 appears in SCOPe 2.07