Class b: All beta proteins [48724] (180 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
Protein automated matches [226835] (41 species) not a true protein |
Species Bacillus sp. [TaxId:535911] [225473] (1 PDB entry) |
Domain d3dc0a2: 3dc0 A:348-425 [209070] Other proteins in same PDB: d3dc0a1 automated match to d1baga1 complexed with ca |
PDB Entry: 3dc0 (more details), 2.78 Å
SCOPe Domain Sequences for d3dc0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dc0a2 b.71.1.0 (A:348-425) automated matches {Bacillus sp. [TaxId: 535911]} qpeelsnpngnnqifmnqrgskgvvlanagsssvsinastklpdgsydnkagtgsfqvrd gkltgtinarsvavlypd
Timeline for d3dc0a2: