![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
![]() | Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88576] (287 PDB entries) |
![]() | Domain d1hinh2: 1hin H:113-228 [20907] Other proteins in same PDB: d1hinh1, d1hinl1, d1hinl2 part of Fab 17/9 |
PDB Entry: 1hin (more details), 3.1 Å
SCOP Domain Sequences for d1hinh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hinh2 b.1.1.2 (H:113-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)} aakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqs dlytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr
Timeline for d1hinh2: