SCOP 1.55: Domain d1hinh2: 1hin H:113-228

Lineage for d1hinh2 (1hin H:113-228)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species Fab 17/9 (mouse), kappa L chain [48980] (4 PDB entries)

8. Domain d1hinh2: 1hin H:113-228 [20907]
   Other proteins in same PDB: d1hinh1, d1hinl1

Details for d1hinh2

PDB Entry: 1hin, 3.1 Å

PDB Description: structural evidence for induced fit as a mechanism for antibody-antigen recognition

SCOP Domain Sequences for d1hinh2:

Sequence; same for both SEQRES and ATOM records:

>d1hinh2 b.1.1.2 (H:113-228) Immunoglobulin (constant domains of L and H chains) {Fab 17/9 (mouse), kappa L chain}
aakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqs
dlytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr

Timeline for d1hinh2:

• d1hinh2 appears in SCOP 1.57
  
• d1hinh2 appears in the current release, SCOPe 2.08