Lineage for d3db6a_ (3db6 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2591262Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2591263Protein automated matches [190417] (35 species)
    not a true protein
  7. 2593689Species Zebrafish (Danio rerio) [TaxId:7955] [225503] (8 PDB entries)
  8. 2593693Domain d3db6a_: 3db6 A: [209068]
    automated match to d2jamb_
    complexed with frs

Details for d3db6a_

PDB Entry: 3db6 (more details), 2.85 Å

PDB Description: crystal structure of an activated (thr->asp) polo-like kinase 1 (plk1) catalytic domain in complex with compound 902
PDB Compounds: (A:) Polo-like kinase 1

SCOPe Domain Sequences for d3db6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3db6a_ d.144.1.0 (A:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
keipdvlvdprtmkrymrgrflgkggfakcyeitdmdtkevfagkvvpksmllkphqkek
msteiaihksldnphvvgfhgffedddfvyvvleicrrrsllelhkrrkavtepearyfm
rqtiqgvqylhnnrvihrdlklgnlflnddmdvkigdfglatkiefdgerkkdlcgtpny
iapevlckkghsfevdiwslgcilytllvgkppfetsclketyirikkneysvprhinpv
asalirrmlhadptlrpsvaelltdefftsgyapmrlptscltvppr

SCOPe Domain Coordinates for d3db6a_:

Click to download the PDB-style file with coordinates for d3db6a_.
(The format of our PDB-style files is described here.)

Timeline for d3db6a_: