Lineage for d3daob_ (3dao B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1393810Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1393811Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1394417Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 1394418Protein automated matches [190447] (43 species)
    not a true protein
  7. 1394592Species Eubacterium rectale [225485] (1 PDB entry)
  8. 1394594Domain d3daob_: 3dao B: [209064]
    automated match to d1rlma_
    complexed with 1pe, cit

Details for d3daob_

PDB Entry: 3dao (more details), 1.8 Å

PDB Description: crystal structure of a putative phosphate (eubrec_1417) from eubacterium rectale at 1.80 a resolution
PDB Compounds: (B:) Putative Phosphatse

SCOPe Domain Sequences for d3daob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3daob_ c.108.1.0 (B:) automated matches {Eubacterium rectale}
hhhenlyfqgmikliatdidgtlvkdgsllidpeymsvidrlidkgiifvvcsgrqfsse
fklfapikhkllyitdggtvvrtpkeilktypmdediwkgmcrmvrdelpacdyfaatpd
fcfaedggspifhllrdsygfemrevdditrldrndiikftvfhpdkceelctpvfipaw
nkkahlaaagkewvdcnakgvskwtalsylidrfdllpdevccfgdnlndiemlqnagis
yavsnarqeviaaakhtcapywengvlsvlksfl

SCOPe Domain Coordinates for d3daob_:

Click to download the PDB-style file with coordinates for d3daob_.
(The format of our PDB-style files is described here.)

Timeline for d3daob_: