Lineage for d1hinl2 (1hin L:109-211)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 453918Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 454044Species Mouse (Mus musculus) [TaxId:10090] [88567] (277 PDB entries)
  8. 454344Domain d1hinl2: 1hin L:109-211 [20906]
    Other proteins in same PDB: d1hinh1, d1hinh2, d1hinl1
    part of Fab 17/9

Details for d1hinl2

PDB Entry: 1hin (more details), 3.1 Å

PDB Description: structural evidence for induced fit as a mechanism for antibody-antigen recognition

SCOP Domain Sequences for d1hinl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hinl2 b.1.1.2 (L:109-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOP Domain Coordinates for d1hinl2:

Click to download the PDB-style file with coordinates for d1hinl2.
(The format of our PDB-style files is described here.)

Timeline for d1hinl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hinl1