Lineage for d3d8va2 (3d8v A:264-479)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1806519Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 1806520Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 1806799Family b.81.1.0: automated matches [191560] (1 protein)
    not a true family
  6. 1806800Protein automated matches [190967] (28 species)
    not a true protein
  7. 1806906Species Mycobacterium tuberculosis [TaxId:1773] [224870] (7 PDB entries)
  8. 1806912Domain d3d8va2: 3d8v A:264-479 [209043]
    Other proteins in same PDB: d3d8va1
    automated match to d1g95a1
    complexed with ud1

Details for d3d8va2

PDB Entry: 3d8v (more details), 2.55 Å

PDB Description: Crystal structure of GlmU from Mycobacterium tuberculosis in complex with uridine-diphosphate-N-acetylglucosamine
PDB Compounds: (A:) Bifunctional protein glmU

SCOPe Domain Sequences for d3d8va2:

Sequence, based on SEQRES records: (download)

>d3d8va2 b.81.1.0 (A:264-479) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
vtvvdpattwidvdvtigrdtvihpgtqllgrtqiggrcvvgpdttltdvavgdgasvvr
thgssssigdgaavgpftylrpgtalgadgklgafvevknstigtgtkvphltyvgdadi
geysnigassvfvnydgtskrrttvgshvrtgsdtmfvapvtigdgaytgagtvvredvp
pgalavsagpqrnienwvqrkrpgspaaqaskrase

Sequence, based on observed residues (ATOM records): (download)

>d3d8va2 b.81.1.0 (A:264-479) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
vtvvdpattwidvdvtigrdtvihpgtqllgrtqiggrcvvgpdttltdvavgdgasvvr
thgssssigdgaavgpftylrpgtalgadgklgafvevknstigtgtkvphltyvgdadi
geysnigassvfvnydtskrrttvgshvrtgsdtmfvapvtigdgaytgagtvvredvpp
galavsagpqrnienwvqrkrpgspaaqaskrase

SCOPe Domain Coordinates for d3d8va2:

Click to download the PDB-style file with coordinates for d3d8va2.
(The format of our PDB-style files is described here.)

Timeline for d3d8va2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3d8va1