SCOP 1.65: Domain d1himm2: 1him M:113-228

Lineage for d1himm2 (1him M:113-228)

Root: SCOP 1.65
Class b: All beta proteins [48724] (126 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
Species Mouse (Mus musculus) [TaxId:10090] [88576] (237 PDB entries)
Domain d1himm2: 1him M:113-228 [20904]
Other proteins in same PDB: d1himh1, d1himh2, d1himj1, d1himj2, d1himl1, d1himm1
part of Fab 17/9; chain identifiers are mixed up
complexed with nh2

Details for d1himm2

PDB Entry: 1him (more details), 2.9 Å

PDB Description: structural evidence for induced fit as a mechanism for antibody- antigen recognition

SCOP Domain Sequences for d1himm2:

Sequence, based on SEQRES records: (download)

>d1himm2 b.1.1.2 (M:113-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
aakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqs
dlytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr

Sequence, based on observed residues (ATOM records): (download)

>d1himm2 b.1.1.2 (M:113-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
aakttapsvyplapvgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytl
sssvtvtsstwpsqsitcnvahpasstkvdkkiepr

SCOP Domain Coordinates for d1himm2:

Click to download the PDB-style file with coordinates for d1himm2.
(The format of our PDB-style files is described here.)

Timeline for d1himm2: