Lineage for d3d7tb_ (3d7t B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1929232Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1929422Protein c-src tyrosine kinase [56155] (2 species)
    PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase
  7. 1929423Species Chicken (Gallus gallus) [TaxId:9031] [56157] (39 PDB entries)
  8. 1929495Domain d3d7tb_: 3d7t B: [209039]
    Other proteins in same PDB: d3d7ta_
    automated match to d2gqgb_
    complexed with stu

Details for d3d7tb_

PDB Entry: 3d7t (more details), 2.9 Å

PDB Description: structural basis for the recognition of c-src by its inactivator csk
PDB Compounds: (B:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d3d7tb_:

Sequence, based on SEQRES records: (download)

>d3d7tb_ d.144.1.7 (B:) c-src tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]}
daweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkkl
rheklvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdmaaqiasgmayv
ermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikwtapeaalyg
rftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcq
cwrkdpeerptfeylqafledyftstepqyqpgenl

Sequence, based on observed residues (ATOM records): (download)

>d3d7tb_ d.144.1.7 (B:) c-src tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]}
daweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkkl
rheklvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdmaaqiasgmayv
ermnyvhrdlraanilvgenlvckvadfglarlikfpikwtapeaalygrftiksdvwsf
gilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkdpeerpt
feylqafledyftstepqyqpgenl

SCOPe Domain Coordinates for d3d7tb_:

Click to download the PDB-style file with coordinates for d3d7tb_.
(The format of our PDB-style files is described here.)

Timeline for d3d7tb_: