Lineage for d3d7na_ (3d7n A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2102350Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2102815Family c.23.5.0: automated matches [191330] (1 protein)
    not a true family
  6. 2102816Protein automated matches [190158] (24 species)
    not a true protein
  7. 2102817Species Agrobacterium tumefaciens [TaxId:176299] [225483] (1 PDB entry)
  8. 2102818Domain d3d7na_: 3d7n A: [209038]
    automated match to d2a5la1

Details for d3d7na_

PDB Entry: 3d7n (more details), 2.3 Å

PDB Description: The crystal structure of the flavodoxin, WrbA-like protein from Agrobacterium tumefaciens
PDB Compounds: (A:) Flavodoxin, WrbA-like protein

SCOPe Domain Sequences for d3d7na_:

Sequence, based on SEQRES records: (download)

>d3d7na_ c.23.5.0 (A:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
ssntvvvyhsgyghthrmaeavaegaeatlhaidaegnlsedgwaaldaadaiifgtpty
mggpswqfkkfadasskpwfsakwqdkvfggftnsaslngdklntlqylvllagqhgglw
vslgikpsnlkssvrndanrmgsyiapmaqsdadaapeemsvgdletarlygarvanvar
qhk

Sequence, based on observed residues (ATOM records): (download)

>d3d7na_ c.23.5.0 (A:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
ssntvvvyhsgyghthrmaeavaegaeatlhaidaegnlsedgwaaldaadaiifgtpty
mggpswqfkkfadasskpwfsakwqdkvfggftnsaslngdklntlqylvllagqhgglw
vslgyiapmaqsemsvgdletarlygarvanvarqhk

SCOPe Domain Coordinates for d3d7na_:

Click to download the PDB-style file with coordinates for d3d7na_.
(The format of our PDB-style files is described here.)

Timeline for d3d7na_: