Lineage for d3d7ex2 (3d7e X:255-499)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884335Family c.55.1.4: Glycerol kinase [53089] (1 protein)
  6. 2884336Protein Glycerol kinase [53090] (2 species)
  7. 2884337Species Enterococcus casseliflavus [TaxId:37734] [117641] (8 PDB entries)
    Uniprot O34153 5-491
  8. 2884369Domain d3d7ex2: 3d7e X:255-499 [209037]
    automated match to d3ezwd2
    complexed with gol; mutant

Details for d3d7ex2

PDB Entry: 3d7e (more details), 2.03 Å

PDB Description: enterococcus casseliflavus glycerol kinase mutant his232ala complexed with glycerol
PDB Compounds: (X:) glycerol kinase

SCOPe Domain Sequences for d3d7ex2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d7ex2 c.55.1.4 (X:255-499) Glycerol kinase {Enterococcus casseliflavus [TaxId: 37734]}
mafekgmikntygtgafivmntgeepqlsdndllttigygingkvyyalegsifvagsai
qwlrdglrmietspqseelaakakgdnevyvvpaftglgapywdseargavfgltrgttk
edfvratlqavayqskdvidtmkkdsgidipllkvdggaakndllmqfqadildidvqra
anlettalgaaylaglavgfwkdldelksmaeegqmftpempaeerdnlyegwkqavaat
qtfkf

SCOPe Domain Coordinates for d3d7ex2:

Click to download the PDB-style file with coordinates for d3d7ex2.
(The format of our PDB-style files is described here.)

Timeline for d3d7ex2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3d7ex1