Lineage for d3d6rb1 (3d6r B:83-202)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1448585Fold d.299: Ns1 effector domain-like [143020] (1 superfamily)
    beta-X-beta(5)-alpha-beta-alpha; 2 layers: a/b; bifurcated beta-sheet; order 23654[1,7]
  4. 1448586Superfamily d.299.1: Ns1 effector domain-like [143021] (1 family) (S)
    automatically mapped to Pfam PF00600
  5. 1448587Family d.299.1.1: Ns1 effector domain-like [143022] (2 proteins)
    C-terminal part of Pfam PF00600
  6. 1448592Protein automated matches [190936] (5 species)
    not a true protein
  7. 1448601Species Influenza A virus [TaxId:381517] [189222] (9 PDB entries)
  8. 1448604Domain d3d6rb1: 3d6r B:83-202 [209032]
    automated match to d3kwgb_

Details for d3d6rb1

PDB Entry: 3d6r (more details), 2 Å

PDB Description: Structure of an avian influenza A virus NS1 protein effector domain
PDB Compounds: (B:) Non-structural protein 1

SCOPe Domain Sequences for d3d6rb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d6rb1 d.299.1.1 (B:83-202) automated matches {Influenza A virus [TaxId: 381517]}
sspapryitdmsieeisrewymlmprqkitgglmvkmdqaimdkritlkanfsvlfdqle
tlvslraftddgaivaeispipsmpghstedvknaigiligglewndnsiraseniqrfa

SCOPe Domain Coordinates for d3d6rb1:

Click to download the PDB-style file with coordinates for d3d6rb1.
(The format of our PDB-style files is described here.)

Timeline for d3d6rb1: