| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187694] (14 PDB entries) |
| Domain d3d6ib_: 3d6i B: [209030] automated match to d1r26a_ complexed with so4 |
PDB Entry: 3d6i (more details), 1.5 Å
SCOPe Domain Sequences for d3d6ib_:
Sequence, based on SEQRES records: (download)
>d3d6ib_ c.47.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pvieindqeqftyltttaagdklivlyfhtswaepckalkqvfeaisnepsnsnvsflsi
dadenseiselfeisavpyfiiihkgtilkelsgadpkeyvslledcknsvn
>d3d6ib_ c.47.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pvieindqeqftyltttaagdklivlyfhtswalkqvfeaisnepsnsnvsflsidaden
seiselfeisavpyfiiihkgtilkelsgadpkeyvslledcknsvn
Timeline for d3d6ib_: