Lineage for d3d6ia_ (3d6i A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879136Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187694] (14 PDB entries)
  8. 2879140Domain d3d6ia_: 3d6i A: [209029]
    automated match to d1r26a_
    complexed with so4

Details for d3d6ia_

PDB Entry: 3d6i (more details), 1.5 Å

PDB Description: structure of the thioredoxin-like domain of yeast glutaredoxin 3
PDB Compounds: (A:) Monothiol glutaredoxin-3

SCOPe Domain Sequences for d3d6ia_:

Sequence, based on SEQRES records: (download)

>d3d6ia_ c.47.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pvieindqeqftyltttaagdklivlyfhtswaepckalkqvfeaisnepsnsnvsflsi
dadenseiselfeisavpyfiiihkgtilkelsgadpkeyvslledcknsvn

Sequence, based on observed residues (ATOM records): (download)

>d3d6ia_ c.47.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pvieindqeqftyltttaagdklivlyfhtswpckalkqvfeaisnepsnsnvsflsida
denseiselfeisavpyfiiihkgtilkelsgadpkeyvslledcknsvn

SCOPe Domain Coordinates for d3d6ia_:

Click to download the PDB-style file with coordinates for d3d6ia_.
(The format of our PDB-style files is described here.)

Timeline for d3d6ia_: