SCOPe 2.08: Domain d3d6ia_: 3d6i A:

Lineage for d3d6ia_ (3d6i A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187694] (14 PDB entries)

8. Domain d3d6ia_: 3d6i A: [209029]
   automated match to d1r26a_
   complexed with so4

Details for d3d6ia_

PDB Entry: 3d6i, 1.5 Å

PDB Description: structure of the thioredoxin-like domain of yeast glutaredoxin 3

PDB Compounds: (A:) Monothiol glutaredoxin-3

SCOPe Domain Sequences for d3d6ia_:

Sequence, based on SEQRES records:

>d3d6ia_ c.47.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pvieindqeqftyltttaagdklivlyfhtswaepckalkqvfeaisnepsnsnvsflsi
dadenseiselfeisavpyfiiihkgtilkelsgadpkeyvslledcknsvn

Sequence, based on observed residues (ATOM records):

>d3d6ia_ c.47.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pvieindqeqftyltttaagdklivlyfhtswpckalkqvfeaisnepsnsnvsflsida
denseiselfeisavpyfiiihkgtilkelsgadpkeyvslledcknsvn

Timeline for d3d6ia_:

• d3d6ia_ first appeared in SCOPe 2.03
  
• d3d6ia_ appears in SCOPe 2.07