SCOPe 2.03: Domain d3d6bc1: 3d6b C:4-242

Lineage for d3d6bc1 (3d6b C:4-242)

1. Root: SCOPe 2.03

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
   2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology

4. Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families)
   flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)

5. Family e.6.1.0: automated matches [227203] (1 protein)
   not a true family

6. Protein automated matches [226934] (14 species)
   not a true protein

7. Species Burkholderia pseudomallei [TaxId:320372] [225462] (6 PDB entries)

8. Domain d3d6bc1: 3d6b C:4-242 [209021]
   Other proteins in same PDB: d3d6ba2, d3d6bb2, d3d6bc2, d3d6bd2
   automated match to d1siqa2
   complexed with 54d

Details for d3d6bc1

PDB Entry: 3d6b, 2.21 Å

PDB Description: 2.2 a crystal structure of glutaryl-coa dehydrogenase from burkholderia pseudomallei

PDB Compounds: (C:) Glutaryl-CoA dehydrogenase

SCOPe Domain Sequences for d3d6bc1:

Sequence, based on SEQRES records:

>d3d6bc1 e.6.1.0 (C:4-242) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
atfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremgeigl
lgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaqkeky
lpklatgewigcfgltepnhgsdpgsmvtrarkvpggyslsgskmwitnspiadvfvvwa
kldedgrdeirgfilekgckglsapaihgkvglrasitgeivldeafvpeenilphvkg

Sequence, based on observed residues (ATOM records):

>d3d6bc1 e.6.1.0 (C:4-242) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
atfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremgeigl
lgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaqkeky
lpklatgewigcfgltepnhggsmvtrarkvpggyslsgskmwitnspiadvfvvwakld
edgrdeirgfilekgckglsapaihgkvglrasitgeivldeafvpeenilphvkg

Timeline for d3d6bc1:

• d3d6bc1 is new in SCOPe 2.03-stable
  
• d3d6bc1 appears in SCOPe 2.04
  
• d3d6bc1 appears in the current release, SCOPe 2.08